anti-Human POU Domain, Class 3, Transcription Factor 4 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended POU Domain, Class 3, Transcription Factor 4 Antibody (geliefert von: Anmelden zum Anzeigen )

POU Domain, Class 3, Transcription Factor 4 (POU3F4) Antikörper
  • brn4
  • dfn3
  • otf9
  • XlPOU2
  • brain-4
  • BRAIN-4
  • BRN-4
  • BRN4
  • DFN3
  • DFNX2
  • OCT-9
  • OTF-9
  • OTF9
  • POU 2
  • XlPOU-2
  • pou2
  • pou3f4-a
  • RHS2
  • Brain-4
  • Brn-4
  • Brn4
  • Otf9
  • Slf
  • oct-9
  • POU class 3 homeobox 4
  • POU class 3 homeobox 4 L homeolog
  • POU domain, class 3, transcription factor 4
  • POU3F4
  • pou3f4
  • pou3f4.L
  • Pou3f4
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4285272
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.623753 ABIN1387287 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal


Antigen POU Domain, Class 3, Transcription Factor 4 (POU3F4) Antikörper
Reaktivität Human
(6), (5), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Wirt Kaninchen
(5), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(6), (1), (1), (1)
Pubmed 1 Publikation vorhanden
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Referenzen Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Referenzen Bilder zurück nach oben
Andere Bezeichnung BRN4 (POU3F4 Antibody Abstract)
Hintergrund Gene Symbol: POU3F4
Gen-ID 5456
Forschungsgebiet Transcription Factors, Chromatin and Nuclear Signaling
Pathways Sensory Perception of Sound


Produktdetails Antigendetails Handhabung Referenzen Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Referenzen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Produkt verwendet in:

Diaz-de-Durana, Lau, Knee, Filippi, Londei, McNamara, Nasoff, DiDonato, Glynne, Herman: "IL-2 immunotherapy reveals potential for innate beta cell regeneration in the non-obese diabetic mouse model of autoimmune diabetes." in: PLoS ONE, Vol. 8, Issue 10, pp. e78483, 2013


Produktdetails Antigendetails Anwendungsinformationen Handhabung Referenzen zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-POU Domain, Class 3, Transcription Factor 4 (POU3F4) antibody (ABIN4285272) Immunohistochemistry-Paraffin: BRN4 Antibody [NBP1-89934] - Staining of human lateral...
Western Blotting (WB) image for anti-POU Domain, Class 3, Transcription Factor 4 (POU3F4) antibody (ABIN4285272) Western Blot: BRN4 Antibody [NBP1-89934] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-POU Domain, Class 3, Transcription Factor 4 (POU3F4) antibody (ABIN4285272) Immunohistochemistry-Paraffin: BRN4 Antibody - Staining of human cerebral cortex sho...