anti-Maus BRK1 Antikörper für Western Blotting

Recommended BRK1 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) Antikörper
  • brk1
  • C22H3orf10
  • brick1
  • c3orf10
  • C3orf10
  • MDS027
  • hHBrk1
  • 6720456B07Rik
  • AW011779
  • ATBRK1
  • BRICK1
  • HSPC300
  • T9I22.8
  • T9I22_8
  • BRICK1, SCAR/WAVE actin-nucleating complex subunit
  • BRICK1, SCAR/WAVE actin nucleating complex subunit
  • brick 1
  • BRICK1, SCAR/WAVE actin-nucleating complex subunit S homeolog
  • BRICK1
  • brk1
  • BRK1
  • Brk1
  • brk1.S
Epitop
Middle Region
1
1
Reaktivität
Human, Maus, Ratte (Rattus), Hund, Zebrafisch (Danio rerio)
29
24
22
3
3
2
2
2
1
1
Wirt
Kaninchen
25
4
Klonalität
Polyklonal
Konjugat
Dieser BRK1 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
13
13
11
9
5
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Bilder

Produktnummer ABIN629872
$ 388.93
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
10.842518 ABIN2784463 IHC WB Rabbit Middle Region Anmelden zum Anzeigen Polyclonal 0
10.842518 ABIN2434746 IHC ELISA WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
7 ABIN341474 IHC IHC (p) WB Rabbit IgG C-Term Anmelden zum Anzeigen Polyclonal 0
4.842518 ABIN2463416 IHC ELISA WB Rabbit Anmelden zum Anzeigen Polyclonal 0
1 ABIN710045 IHC (p) WB HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN710038 IHC (p) WB Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN710036 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0
1 ABIN6041476 ELISA IHC WB Rabbit IgG Anmelden zum Anzeigen Polyclonal 0

General

Antigen BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) Antikörper
Epitop Middle Region
(1), (1)
Reaktivität Human, Maus, Ratte (Rattus), Hund, Zebrafisch (Danio rerio)
(29), (24), (22), (3), (3), (2), (2), (2), (1), (1)
Wirt Kaninchen
(25), (4)
Klonalität
Polyklonal
Konjugat Dieser BRK1 Antikörper ist unkonjugiert
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Western Blotting (WB)
(13), (13), (11), (9), (5)
Hersteller Anmelden zum Anzeigen

Produktdetails anti-BRK1 Antikörper

Target Details BRK1 Anwendungsinformationen Handhabung Bilder
Spezifität C3 ORF10 antibody was raised against the middle region of C3 rf10
Reinigung Purified
Immunogen C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
Plasmids, Primers & others

Target Details BRK1

Produktdetails anti-BRK1 Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung C3ORF10 (BRK1 Antibody Abstract)
Hintergrund C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
Molekulargewicht 9 kDa (MW of target protein)
Pathways RTK Signalweg

Anwendungsinformationen

Produktdetails anti-BRK1 Antikörper Target Details BRK1 Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails anti-BRK1 Antikörper Target Details BRK1 Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Bilder

Produktdetails anti-BRK1 Antikörper Target Details BRK1 Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to...
Immunohistochemistry (IHC) image for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. M...
Western Blotting (WB) image for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody used at 2.5 ug/ml to detect target protein.