anti-Human LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) Antikörper für Immunohistochemistry

Recommended LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) Antibody (geliefert von: Anmelden zum Anzeigen )

LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM5) Antikörper
  • K24G6.21
  • K24G6_21
  • An13g00820
  • YER146W
  • 2010208O10Rik
  • 2310034K10Rik
  • LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated
  • LSM5 homolog, U6 small nuclear RNA and mRNA degradation associated L homeolog
  • Small nuclear ribonucleoprotein family protein
  • U6 snRNA-associated Sm-like protein LSm5
  • Lsm5
  • LSM5
  • lsm5.L
  • SAD1
  • ANI_1_116114
  • PVX_118325
  • SS1G_05691
  • Bm1_50275
  • Bm1_50295
  • AOR_1_212174
  • lsm5
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren


Produktnummer ABIN4331773
Preis und Verfügbarkeit auf Anfrage.


Antigen LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM5) Antikörper
Reaktivität Human
(27), (8), (8), (4), (4), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Wirt Kaninchen
(11), (9), (7)
Konjugat Unkonjugiert
(1), (1), (1), (1), (1), (1)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(21), (16), (4), (4), (4), (3), (2), (1)
Hersteller Anmelden zum Anzeigen


Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLV
Isotyp IgG


Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung LSM5 (LSM5 Antibody Abstract)
Hintergrund Gene Symbol: LSM5
Gen-ID 23658
Pathways Response to Water Deprivation


Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM5) antibody (ABIN4331773) Western Blot: LSM5 Antibody [NBP1-92082] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-LSM5 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM5) antibody (ABIN4331773) Immunohistochemistry-Paraffin: LSM5 Antibody [NBP1-92082] - Staining of human duodenu...