Endomucin Protein (EMCN) (Monomer, Soluble) (His tag)

Produktnummer ABIN1589739

Produktdetails

Target: Endomucin (EMCN)

Protein-Typ: Recombinant

Proteineigenschaft: Monomer, Soluble

Spezies: Human

Quelle: Escherichia coli (E. coli)

Aufreinigungstag / Konjugat: Dieses Endomucin Protein ist gelabelt mit His tag.

Sequenz: MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVV TTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMS LMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLP NAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGT LTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS

Produktmerkmale: Length (AA): 197
Chromosomal location: 4q24

Reinheit: > 95 % by SDS-PAGE. Visualized by silver stain

Anwendungsinformationen

Applikationshinweise: No biological data available at the moment.

Kommentare:

Soluble Receptors

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: The lyophilized human soluble Endomucin is soluble in water and most aqueous buffers, it should be reconstituted in water or PBS to a concentration of not lower than 100 μg/mL.

Buffer: 10 mM NaP, pH 7.0

Lagerung: -20 °C/-80 °C

Informationen zur Lagerung: The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity.

Haltbarkeit: 6 months

Antigendetails

Target: Endomucin (EMCN)

Andere Bezeichnung: Endomucin (EMCN Produkte)

Synonyme: EMCN2 Protein, MUC14 Protein, 0610012K22Rik Protein, AI315669 Protein, Muc14 Protein, endomucin Protein, EMCN Protein, Emcn Protein

Hintergrund: Endomucin (endothelial sialomucin, also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60 % and 30 % aa identity with rat and human Endomucin, respectively.
Synonyms: Endomucin-2, Gastric cancer antigen Ga34, Mucin-14

Molekulargewicht: 20.4 kDa

NCBI Accession: NP_001153166, NM_001159694

UniProt: Q9ULC0