anti-Hund Retinoid X Receptor beta Antikörper für Western Blotting

Recommended Retinoid X Receptor beta Antibody

Retinoid X Receptor, beta (RXRB) Antikörper
  • DAUDI6
  • H-2RIIBP
  • NR2B2
  • RCoR-1
  • RXR-beta
  • RXRbeta
  • rxrb
  • RXRB
  • nr2b2
  • daudi6
  • rcor-1
  • h-2riibp
  • NR2B2-A
  • RXR
  • RXRA
  • etID309733.19
  • rxre
  • wu:fb93c09
  • AL023085
  • Nr2b2
  • Rub
  • rxrd
  • unp286
  • retinoid X receptor beta
  • retinoid X receptor beta S homeolog
  • retinoid x receptor, beta a
  • retinoid x receptor, beta b
  • RXRB
  • Rxrb
  • rxrb.S
  • rxrb
  • rxrba
  • rxrbb
Human, Maus, Ratte (Rattus), Hund
Dieser Retinoid X Receptor beta Antikörper ist unkonjugiert
Western Blotting (WB)


Produktnummer ABIN630493
$ 449.29
Zzgl. Versandkosten $45.00
Relevance Score ABIN Application Konjugat Host Isotype Epitope Clonality References Details
10.857807 ABIN2782297 WB Rabbit N-Term Polyclonal 0
7.857807 ABIN2774660 WB Rabbit N-Term Polyclonal 0
7.857807 ABIN2559796 ELISA WB Goat IgG Internal Region Polyclonal 0
7 ABIN6747189 IHC IHC (p) WB Rabbit IgG AA 74-123 Polyclonal 0
4.857807 ABIN2782298 WB Rabbit N-Term Polyclonal 0
4.857807 ABIN2781169 WB Rabbit C-Term Polyclonal 0
4.857807 ABIN2461920 ELISA WB Rabbit Polyclonal 0
4.857807 ABIN2462873 ELISA WB Rabbit Polyclonal 0
4 ABIN295661 ELISA WB Goat AA 70-83 Polyclonal 0
4 ABIN6737878 WB Rabbit IgG AA 451-500 Polyclonal 0
4 ABIN6738181 WB Rabbit IgG AA 151-200 Polyclonal 0


Antigen Retinoid X Receptor, beta (RXRB) Antikörper
Epitop N-Term
(11), (11), (9), (8), (8), (6), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reaktivität Human, Maus, Ratte (Rattus), Hund
(78), (27), (24), (11), (9), (8), (7), (5), (5), (4), (4), (1), (1)
Wirt Kaninchen
(47), (18), (17)
Konjugat Dieser Retinoid X Receptor beta Antikörper ist unkonjugiert
(3), (3), (3), (3), (3), (3)
Applikation Western Blotting (WB)
(81), (46), (6), (4), (3), (2), (1), (1)

Produktdetails anti-Retinoid X Receptor beta Antikörper

Target Details Retinoid X Receptor beta Anwendungsinformationen Handhabung Bilder
Spezifität RXRB antibody was raised against the N terminal of RXRB
Reinigung Affinity purified
Immunogen RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA
Plasmids, Primers & others

Target Details Retinoid X Receptor beta

Produktdetails anti-Retinoid X Receptor beta Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben
Andere Bezeichnung RXRB (RXRB Antibody Abstract)
Hintergrund RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.
Molekulargewicht 57 kDa (MW of target protein)
Pathways Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway


Produktdetails anti-Retinoid X Receptor beta Antikörper Target Details Retinoid X Receptor beta Handhabung Bilder zurück nach oben
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

RXRB Blocking Peptide, catalog no. 33R-7103, is also available for use as a blocking control in assays to test for specificity of this RXRB antibody

Beschränkungen Nur für Forschungszwecke einsetzbar


Produktdetails anti-Retinoid X Receptor beta Antikörper Target Details Retinoid X Receptor beta Anwendungsinformationen Bilder zurück nach oben
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Produktdetails anti-Retinoid X Receptor beta Antikörper Target Details Retinoid X Receptor beta Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Western Blotting (WB) image for anti-Retinoid X Receptor, beta (RXRB) (N-Term) antibody (ABIN630493) RXRB antibody used at 1 ug/ml to detect target protein.