anti-Hund Retinoid X Receptor beta Antikörper für Western Blotting
Recommended Retinoid X Receptor beta Antibody
- Antigen
-
Retinoid X Receptor, beta (RXRB) Antikörper
Synonyme für dieses Antigen anzeigen- DAUDI6
- H-2RIIBP
- NR2B2
- RCoR-1
- RXR-beta
- RXRbeta
- rxrb
- RXRB
- nr2b2
- daudi6
- rcor-1
- h-2riibp
- NR2B2-A
- RXR
- RXRA
- etID309733.19
- rxre
- wu:fb93c09
- AL023085
- Nr2b2
- Rub
- rxrd
- unp286
- retinoid X receptor beta
- retinoid X receptor beta S homeolog
- retinoid x receptor, beta a
- retinoid x receptor, beta b
- RXRB
- Rxrb
- rxrb.S
- rxrb
- rxrba
- rxrbb
- Epitop
-
N-Term
Alternativen - Reaktivität
-
Human, Maus, Ratte (Rattus), Hund
Alternativen - Wirt
-
Kaninchen
Alternativen - Klonalität
- Konjugat
-
Dieser Retinoid X Receptor beta Antikörper ist unkonjugiert
Alternativen - Applikation
-
Western Blotting (WB)
Alternativen - Optionen
Produktnummer ABIN630493
$ 449.29
Zzgl. Versandkosten $45.00
Zzgl. Versandkosten $45.00
Relevance Score | ABIN | Application | Konjugat | Host | Isotype | Epitope | Clonality | References | Details |
---|---|---|---|---|---|---|---|---|---|
10.896469 | ABIN2782297 | WB | Rabbit | N-Term | Polyclonal | 0 | |||
7.8964696 | ABIN2774660 | WB | Rabbit | N-Term | Polyclonal | 0 | |||
7.8964696 | ABIN2559796 | ELISA WB | Goat | IgG | Internal Region | Polyclonal | 0 | ||
7 | ABIN6747189 | IHC IHC (p) WB | Rabbit | IgG | AA 74-123 | Polyclonal | 0 | ||
4.8964696 | ABIN2782298 | WB | Rabbit | N-Term | Polyclonal | 0 | |||
4.8964696 | ABIN2781169 | WB | Rabbit | C-Term | Polyclonal | 0 | |||
4.8964696 | ABIN2461920 | ELISA WB | Rabbit | Polyclonal | 0 | ||||
4.8964696 | ABIN2462873 | ELISA WB | Rabbit | Polyclonal | 0 | ||||
4 | ABIN295661 | ELISA WB | Goat | AA 70-83 | Polyclonal | 0 | |||
4 | ABIN6737878 | WB | Rabbit | IgG | AA 451-500 | Polyclonal | 0 | ||
4 | ABIN6738181 | WB | Rabbit | IgG | AA 151-200 | Polyclonal | 0 |
General |
|
---|---|
Antigen | Retinoid X Receptor, beta (RXRB) Antikörper |
Epitop | N-Term Alternativen |
Reaktivität | Human, Maus, Ratte (Rattus), Hund Alternativen |
Wirt | Kaninchen Alternativen |
Klonalität | |
Konjugat | Dieser Retinoid X Receptor beta Antikörper ist unkonjugiert Alternativen |
Applikation |
Western Blotting (WB)
Alternativen
|
Hersteller | |
Produktdetails anti-Retinoid X Receptor beta AntikörperTarget Details Retinoid X Receptor beta Anwendungsinformationen Handhabung Bilder |
|
Spezifität | RXRB antibody was raised against the N terminal of RXRB |
Reinigung | Affinity purified |
Immunogen | RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA |
Plasmids, Primers & others | |
Target Details Retinoid X Receptor betaProduktdetails anti-Retinoid X Receptor beta Antikörper Anwendungsinformationen Handhabung Bilder zurück nach oben |
|
Antigen | |
Andere Bezeichnung | RXRB (RXRB Antibody Abstract) |
Hintergrund | RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. |
Molekulargewicht | 57 kDa (MW of target protein) |
Pathways | Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway |
AnwendungsinformationenProduktdetails anti-Retinoid X Receptor beta Antikörper Target Details Retinoid X Receptor beta Handhabung Bilder zurück nach oben |
|
Applikations-hinweise |
WB: 1 µg/mL Optimal conditions should be determined by the investigator. |
Kommentare |
RXRB Blocking Peptide, catalog no. 33R-7103, is also available for use as a blocking control in assays to test for specificity of this RXRB antibody |
Beschränkungen | Nur für Forschungszwecke einsetzbar |
HandhabungProduktdetails anti-Retinoid X Receptor beta Antikörper Target Details Retinoid X Receptor beta Anwendungsinformationen Bilder zurück nach oben |
|
Format | Lyophilized |
Rekonstitution | Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS |
Konzentration | Lot specific |
Buffer | PBS |
Handhabung |
Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use. |
Lagerung | 4 °C |
Informationen zur Lagerung | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. |
BilderProduktdetails anti-Retinoid X Receptor beta Antikörper Target Details Retinoid X Receptor beta Anwendungsinformationen Handhabung zurück nach oben |
|
Bilder des Herstellers |