anti-Human Dehydrogenase/reductase (SDR Family) Member 9 Antikörper für Immunohistochemistry (Paraffin-embedded Sections)

Recommended Dehydrogenase/reductase (SDR Family) Member 9 Antibody (geliefert von: Anmelden zum Anzeigen )

Antigen
Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) Antikörper
  • 3ALPHA-HSD
  • RDH-TBE
  • RDH15
  • RDHL
  • RDHTBE
  • RETSDR8
  • SDR9C4
  • Rdhl
  • C730025I08Rik
  • Rdh15
  • rdhl
  • 3alpha-hsd
  • rdh15
  • retsdr8
  • DHRS9
  • RDHA
  • rdh1l
  • wu:fb64b07
  • zgc:73286
  • dehydrogenase/reductase 9
  • dehydrogenase/reductase (SDR family) member 9
  • dehydrogenase/reductase (SDR family) member 9 L homeolog
  • DHRS9
  • Dhrs9
  • dhrs9.L
  • dhrs9
Reaktivität
Human
44
9
9
2
1
1
1
1
1
1
Wirt
Kaninchen
37
8
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
37
18
10
7
6
5
2
2
2
1
1
1
1
1
1
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Produkt kostenlos erhalten?

Für Ihre Validierungsdaten erstatten wir Ihnen den vollen Kaufpreis. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Produktnummer ABIN4305169
Preis und Verfügbarkeit auf Anfrage.
Relevance Score ABIN Application Konjugat Host Isotype Epitope Hersteller Clonality References Details
12.426896 ABIN4305170 ICC IF IHC IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN872705 IF (p) IHC (p) WB Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2598437 ELISA IHC IHC (p) HRP Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2598438 ELISA IHC IHC (p) Biotin Rabbit IgG Anmelden zum Anzeigen Polyclonal
1 ABIN2598439 ELISA IHC IHC (p) FITC Rabbit IgG Anmelden zum Anzeigen Polyclonal

General

Antigen Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) Antikörper
Reaktivität Human
(44), (9), (9), (2), (1), (1), (1), (1), (1), (1)
Wirt Kaninchen
(37), (8)
Klonalität
Polyklonal
Konjugat Unkonjugiert
(3), (3), (3)
Applikation Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(37), (18), (10), (7), (6), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Hersteller Anmelden zum Anzeigen

Produktdetails

Antigendetails Anwendungsinformationen Handhabung Bilder
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKA
Isotyp IgG

Antigendetails

Produktdetails Anwendungsinformationen Handhabung Bilder zurück nach oben
Antigen
Andere Bezeichnung DHRS9 (DHRS9 Antibody Abstract)
Hintergrund Gene Symbol: DHRS9
Gen-ID 10170
Forschungsgebiet Metabolism
Pathways C21-Steroid Hormone Metabolic Process

Anwendungsinformationen

Produktdetails Antigendetails Handhabung Bilder zurück nach oben
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar

Handhabung

Produktdetails Antigendetails Anwendungsinformationen Bilder zurück nach oben
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Bilder

Produktdetails Antigendetails Anwendungsinformationen Handhabung zurück nach oben
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) antibody (ABIN4305169) Immunohistochemistry-Paraffin: DHRS9 Antibody [NBP1-89378] - Staining of human pancre...
Western Blotting (WB) image for anti-Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) antibody (ABIN4305169) Western Blot: DHRS9 Antibody [NBP1-89378] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9) antibody (ABIN4305169) Immunohistochemistry-Paraffin: DHRS9 Antibody - Staining of human stomach shows mode...