Tissue factor Antikörper (AA 45-154)
-
- Target Alle Tissue factor (F3) Antikörper anzeigen
- Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))
-
Bindungsspezifität
- AA 45-154
-
Reaktivität
- Human
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser Tissue factor Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), ELISA
- Verwendungszweck
- Mouse monoclonal antibody raised against a partial recombinant F3.
- Kreuzreaktivität
- Human
- Immunogen
-
immunogen: F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
- Klon
- 4G4
- Isotyp
- IgG2a kappa
- Top Product
- Discover our top product F3 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
-
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- In ascites fluid
- Handhabung
- Aliquot to avoid repeated freezing and thawing.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
-
Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis." in: PLoS ONE, Vol. 9, Issue 11, pp. e111862, (2014) (PubMed).
: "
-
Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis." in: PLoS ONE, Vol. 9, Issue 11, pp. e111862, (2014) (PubMed).
-
- Target
- Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))
- Andere Bezeichnung
- F3 (F3 Produkte)
- Synonyme
- CD142 antikoerper, TF antikoerper, TFA antikoerper, PRO1557 antikoerper, PRO2086 antikoerper, TFQTL1 antikoerper, f3 antikoerper, AA409063 antikoerper, Cf-3 antikoerper, Cf3 antikoerper, tf antikoerper, zgc:112151 antikoerper, coagulation factor III, tissue factor antikoerper, transferrin antikoerper, coagulation factor IIIa antikoerper, coagulation factor III antikoerper, tissue factor antikoerper, coagulation factor IIIb antikoerper, coagulation factor III (thromboplastin, tissue factor) S homeolog antikoerper, F3 antikoerper, TF antikoerper, f3a antikoerper, tf antikoerper, f3b antikoerper, f3.S antikoerper
- Hintergrund
-
Full Gene Name: coagulation factor III (thromboplastin, tissue factor)
Synonyms: CD142,TF,TFA - Gen-ID
- 2152
- Pathways
- Positive Regulation of Endopeptidase Activity, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling
-