MAP3K1 Antikörper (AA 1077-1176)

Produktnummer ABIN7657215

Dieses Anti-MAP3K1-Antikörper ist ein Maus Monoklonal-Antikörper zur Detektion von MAP3K1 in IHC und IHC (fp). Geeignet für Human.

Kurzübersicht für MAP3K1 Antikörper (AA 1077-1176) (ABIN7657215)

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser MAP3K1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp))

Klon: 2F6

Produktdetails anti-MAP3K1 Antikörper

Bindungsspezifität: AA 1077-1176

Verwendungszweck: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(2F6)

Produktmerkmale: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Immunogen: Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Isotyp: IgG2a, kappa

Anwendungsinformationen

Applikationshinweise: Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody. Immunohistochemistry (formalin-fixed): 1-2 μg/mL for 30 minutes at RT. Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM Tris buffer with 1 mM EDTA pH 9.0 for 10-20 minutes followed by cooling at RT for 20 minutes. Western Blot 0.5-1 μg/mL. Optimal dilution for a specific application should be determined by user

Kommentare:

Positive Control: A431, HeLa or HL-60 cells. Liver tissue.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: 1 mg/mL

Buffer: PBS, no BSA, no azide

Konservierungsmittel: Without preservative

Lagerung: -20 °C

Informationen zur Lagerung:

Stable at room temperature or 37°C for 7 days.

Store at -20 °C. Protect fluorescent conjugates from light

Haltbarkeit: 24 months

Details zu MAP3K1

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Andere Bezeichnung: MAP3K1

Hintergrund:

Synonyms: MEKK1, MEK Kinase 1, MEKK, SRXY6, MAPKKK1

Gene Symbol: MAP3K1

Molekulargewicht: 195 kDa (intact), 80 kDa (cleaved)

Gen-ID: 4214

UniProt: Q13233

Pathways: MAPK Signalweg, Interferon-gamma Pathway, Caspase Kaskade in der Apoptose, TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades