MAP3K1 Antikörper (AA 1077-1176)

Produktnummer ABIN6940032

Produktdetails anti-MAP3K1 Antikörper

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Bindungsspezifität: AA 1077-1176

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Konjugat: Dieser MAP3K1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Staining Methods (StM)

Aufreinigung: Purified by Protein A/G

Immunogen: Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Klon: 2F6

Isotyp: IgG2a kappa

Anwendungsinformationen

Applikationshinweise:

Positive Control: A431, HeLa or HL-60 cells. Liver tissue.

Known Application: Western Blot (0.5-1 μg/mL),Immunohistochemistry (Formalin-fixed) (1-2 μg/mL for 30 minutes at RT)(Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM Tris Buffer with 1 mM EDTA, pH 9.0, for 10-20 min followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Konzentration: 200 μg/mL

Buffer: 10 mM PBS with 0.05 % BSA & 0.05 % azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-80 °C

Informationen zur Lagerung: Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

Haltbarkeit: 24 months

Details zu MAP3K1

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Andere Bezeichnung: MAP3K1 (MAP3K1 Produkte)

Synonyme: MAP3K1 antikoerper, Mekk1 antikoerper, MAPKKK1 antikoerper, MEKK1 antikoerper, Mekk antikoerper, ARAKIN antikoerper, ATMEKK1 antikoerper, MAPK/ERK kinase kinase 1 antikoerper, MAPKKK8 antikoerper, T15F16.5 antikoerper, T15F16_5 antikoerper, MEKK antikoerper, MEKK 1 antikoerper, SRXY6 antikoerper, mitogen-activated protein kinase kinase kinase 1 antikoerper, mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase antikoerper, MAPK/ERK kinase kinase 1 antikoerper, MAP3K1 antikoerper, map3k1 antikoerper, Map3k1 antikoerper, MEKK1 antikoerper

Hintergrund: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Molekulargewicht: 195kDa (intact), 80kDa (cleaved)

Gen-ID: 4214

UniProt: Q13233

Pathways: MAPK Signalweg, Interferon-gamma Pathway, Caspase Kaskade in der Apoptose, TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades