KCNA2 Antikörper (C-Term, Intracellular)

Produktnummer ABIN7043517

Produktdetails anti-KCNA2 Antikörper

Target: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Bindungsspezifität: AA 417-499, C-Term, Intracellular

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC)

Produktmerkmale: Anti-Kv1.2 (KCNA2) Antibody is directed against an epitope of rat KV1.2. Anti-KV1.2 (KCNA2) Antibody (ABIN7043517, ABIN7044912 and ABIN7044913)) can be used in western blot, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize KV1.2 from human, rat, and mouse samples.

Aufreinigung: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogen:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Konzentration: 0.8 mg/mL

Buffer: Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 5 % sucrose, 0.025 % Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: RT,4 °C,-20 °C

Informationen zur Lagerung:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Details zu KCNA2

Target: KCNA2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 2 (KCNA2))

Andere Bezeichnung: KV1.2 (KCNA2) (KCNA2 Produkte)

Synonyme: KCNA2 antikoerper, kcna2 antikoerper, HBK5 antikoerper, HK4 antikoerper, HUKIV antikoerper, KV1.2 antikoerper, MK2 antikoerper, NGK1 antikoerper, RBK2 antikoerper, Akr6a4 antikoerper, ENSMUSG00000074335 antikoerper, Gm10672 antikoerper, Kca1-2 antikoerper, Kv1.2 antikoerper, Mk-2 antikoerper, BK2 antikoerper, XSha2 antikoerper, k(v)1.2 antikoerper, kcna2-a antikoerper, kv1.2 antikoerper, potassium voltage-gated channel subfamily A member 2 antikoerper, potassium channel, voltage gated shaker related subfamily A, member 1 antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 2 antikoerper, potassium channel, voltage gated shaker related subfamily A, member 2 S homeolog antikoerper, KCNA2 antikoerper, kcna1 antikoerper, Kcna2 antikoerper, LOC100537815 antikoerper, kcna2.S antikoerper

Hintergrund: Alternative names: KV1.2 (KCNA2), Potassium voltage-gated channel subfamily A member 2, RBK2

Gen-ID: 25468

NCBI Accession: NM_004974

UniProt: P63142