CD68 Antikörper (AA 27-282)
-
- Target Alle CD68 Antikörper anzeigen
- CD68 (CD68 Molecule (CD68))
-
Bindungsspezifität
- AA 27-282
-
Reaktivität
- Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CD68 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Verwendungszweck
- Polyclonal Antibody to Scavenger Receptor Class D Member 1 (SCARD1)
- Spezifität
- The antibody is a rabbit polyclonal antibody raised against SCARD1. It has been selected for its ability to recognize SCARD1 in immunohistochemical staining and western blotting.
- Aufreinigung
- Antigen-specific affinity chromatography followed by Protein A affinity chromatography
- Immunogen
- Recombinant Scavenger Receptor Class D Member 1 (SCARD1) corresdonding to Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA with N-terminal His and GST Tag
- Isotyp
- IgG
- Top Product
- Discover our top product CD68 Primärantikörper
-
-
- Applikationshinweise
-
Western blotting: 0.5-2 μg/mL
Immunohistochemistry: 5-20 μg/mL
Immunocytochemistry: 5-20 μg/mL
Optimal working dilutions must be determined by end user.
- Kommentare
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Liquid
- Buffer
- 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.
- Konservierungsmittel
- ProClin
- Vorsichtsmaßnahmen
- This product contains ProClin: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
- Haltbarkeit
- 24 months
-
- Target
- CD68 (CD68 Molecule (CD68))
- Andere Bezeichnung
- Scavenger Receptor Class D Member 1 (CD68 Produkte)
- Synonyme
- Lamp4 antikoerper, Scard1 antikoerper, gp110 antikoerper, GP110 antikoerper, LAMP4 antikoerper, SCARD1 antikoerper, CD68 molecule antikoerper, CD68 antigen antikoerper, Cd68 molecule antikoerper, CD68 antikoerper, Cd68 antikoerper
- Hintergrund
- CD68, GP110, Macrosialin, Macrophage Antigen CD68
-