PTH Antikörper (AA 1-38)
-
- Target Alle PTH Antikörper anzeigen
- PTH (Parathyroid Hormone (PTH))
-
Bindungsspezifität
- AA 1-38
-
Reaktivität
- Human, Affe
-
Wirt
- Maus
-
Klonalität
- Monoklonal
-
Konjugat
- Dieser PTH Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Spezifität
- Human PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic human PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84,), PTHrP (aa 1-86).
- Homologie
- Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%) Horse (97%) Elephant, Panda, Dog, Pig (94%) Bovine (90%) Hamster, Cat (87%) Rat (84%) Mouse (81%).
- Aufreinigung
- Protein G purified
- Immunogen
- Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%), Horse (97%), Elephant, Panda, Dog, Pig (94%), Bovine (90%), Hamster, Cat (87%), Rat (84%), Mouse (81%).
- Klon
- B2-82
- Isotyp
- IgG1
- Top Product
- Discover our top product PTH Primärantikörper
-
-
- Applikationshinweise
-
Approved: ELISA (1 μg/mL), IHC, IHC-Fr, IHC-P, RIA
Usage: Suitable for use in ELISA: 1 μg/mL. Immunohistochemistry: 2 μg/mL. Frozen, paraffin. RIA: 25 ng/mL. - Kommentare
-
Target Species of Antibody: Human
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Sterile distilled water
- Konzentration
- Lot specific
- Buffer
- Lyophilized from in 50 mM Tris, pH 7.2
- Handhabung
- Aliquot to Avoid repeated freezing and thawing.
- Lagerung
- -20 °C
- Informationen zur Lagerung
- Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.
-
- Target
- PTH (Parathyroid Hormone (PTH))
- Andere Bezeichnung
- Parathyroid Hormone / PTH (PTH Produkte)
- Synonyme
- PTH1 antikoerper, Pthp antikoerper, PTH-(1-84) antikoerper, Pth1 antikoerper, Pthr1 antikoerper, PTH antikoerper, parathyroid hormone antikoerper, parathyroid hormone S homeolog antikoerper, PTH antikoerper, Pth antikoerper, pth.S antikoerper
- Substanzklasse
- Hormone
- Hintergrund
-
Name/Gene ID: PTH
Family: Hormone
Synonyms: PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1 - Gen-ID
- 5741
- UniProt
- P01270
- Pathways
- cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process
-