ZNF566 Antikörper (Internal Region)
-
- Target Alle ZNF566 Antikörper anzeigen
- ZNF566 (Zinc Finger Protein 566 (ZNF566))
-
Bindungsspezifität
- Internal Region
-
Reaktivität
- Human, Pferd, Ratte, Meerschweinchen, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZNF566 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Rat Zpf566
- Aufreinigung
- Immunoaffinity purified
- Immunogen
-
The immunogen for anti-Zfp566 antibody: synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI. Percent identity by BLAST analysis: Rat, Horse, Human, Mouse (100%), Dog, Pig, Bovine, Rabbit, Zebrafish (93%), Guinea pig (86%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product ZNF566 Primärantikörper
-
-
- Applikationshinweise
- Optimal working dilution should be determined by the investigator.
- Kommentare
-
Target Species of Antibody: Rat
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Distilled water
- Konzentration
- Lot specific
- Buffer
- Lyophilized from PBS, 2 % sucrose.
- Handhabung
- Avoid freeze-thaw cycles.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
- Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.
-
- Target
- ZNF566 (Zinc Finger Protein 566 (ZNF566))
- Andere Bezeichnung
- Zfp566 (ZNF566 Produkte)
- Synonyme
- ZNF420 antikoerper, RGD1563239 antikoerper, zinc finger protein 566 antikoerper, ZNF566 antikoerper, Zfp566 antikoerper
- Hintergrund
-
Name/Gene ID: Zfp566
Synonyms: Zfp566 - Gen-ID
- 502316
-