BCAP29 Antikörper (Middle Region)

Produktnummer ABIN636123

Produktdetails anti-BCAP29 Antikörper

Target: BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BCAP29 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BCAP29 antibody was raised against the middle region of BCAP29

Aufreinigung: Affinity purified

Immunogen: BCAP29 antibody was raised using the middle region of BCAP29 corresponding to a region with amino acids GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BCAP29 Blocking Peptide, catalog no. 33R-3644, is also available for use as a blocking control in assays to test for specificity of this BCAP29 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAP29 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BCAP29

Target: BCAP29 (B-Cell Receptor-Associated Protein 29 (BCAP29))

Andere Bezeichnung: BCAP29 (BCAP29 Produkte)

Synonyme: AW208404 antikoerper, Bap29 antikoerper, BAP29 antikoerper, B-cell receptor associated protein 29 antikoerper, B cell receptor associated protein 29 antikoerper, B-cell receptor-associated protein 29 antikoerper, BCAP29 antikoerper, Bcap29 antikoerper

Hintergrund: BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.

Molekulargewicht: 39 kDa (MW of target protein)