TNFRSF21 Antikörper (N-Term)

Produktnummer ABIN636122

Produktdetails anti-TNFRSF21 Antikörper

Target: TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNFRSF21 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TNFRSF21 antibody was raised against the N terminal of TNFRSF21

Aufreinigung: Affinity purified

Immunogen: TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNFRSF21 Blocking Peptide, catalog no. 33R-9334, is also available for use as a blocking control in assays to test for specificity of this TNFRSF21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFRSF21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TNFRSF21

Target: TNFRSF21 (Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21))

Andere Bezeichnung: TNFRSF21 (TNFRSF21 Produkte)

Synonyme: TNFRSF21 antikoerper, tnfrsf21 antikoerper, MGC146356 antikoerper, BM-018 antikoerper, CD358 antikoerper, DR6 antikoerper, AA959878 antikoerper, R74815 antikoerper, TR7 antikoerper, dr6 antikoerper, im:6795346 antikoerper, wu:fa55e01 antikoerper, wu:fb02e11 antikoerper, wu:fc29a09 antikoerper, wu:fi27h08 antikoerper, TNF receptor superfamily member 21 antikoerper, tumor necrosis factor receptor superfamily member 21 antikoerper, tumor necrosis factor receptor superfamily, member 21 antikoerper, TNFRSF21 antikoerper, tnfrsf21 antikoerper, Tnfrsf21 antikoerper

Hintergrund: TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activateNF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction ofTNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha