TSPAN33 Antikörper (Middle Region)

Produktnummer ABIN636117

Produktdetails anti-TSPAN33 Antikörper

Target: TSPAN33 (Tetraspanin 33 (TSPAN33))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPAN33 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Tetraspanin 33 antibody was raised against the middle region of TSPAN33

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 33 antibody was raised using the middle region of TSPAN33 corresponding to a region with amino acids LQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 33 Blocking Peptide, catalog no. 33R-5321, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPAN33

Target: TSPAN33 (Tetraspanin 33 (TSPAN33))

Andere Bezeichnung: Tetraspanin 33 (TSPAN33 Produkte)

Synonyme: zgc:92266 antikoerper, PEN antikoerper, 1300010A20Rik antikoerper, AI035228 antikoerper, Pen antikoerper, RGD1560915 antikoerper, tetraspanin 33 antikoerper, tetraspanin 33a antikoerper, tetraspanin 33 L homeolog antikoerper, TSPAN33 antikoerper, tspan33a antikoerper, tspan33.L antikoerper, Tspan33 antikoerper

Hintergrund: TSPAN33 plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.

Molekulargewicht: 31 kDa (MW of target protein)