Collagen, Type XXVI, alpha 1 (COL26A1) (C-Term) Antikörper
-
- Target Alle Collagen, Type XXVI, alpha 1 (COL26A1) Antikörper anzeigen
- Collagen, Type XXVI, alpha 1 (COL26A1)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EMID2 antibody was raised against the C terminal of EMID2
- Aufreinigung
- Affinity purified
- Immunogen
- EMID2 antibody was raised using the C terminal of EMID2 corresponding to a region with amino acids GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR
- Top Product
- Discover our top product COL26A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EMID2 Blocking Peptide, catalog no. 33R-3653, is also available for use as a blocking control in assays to test for specificity of this EMID2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMID2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Collagen, Type XXVI, alpha 1 (COL26A1)
- Andere Bezeichnung
- EMID2 (COL26A1 Produkte)
- Synonyme
- EMID2 antikoerper, EMI6 antikoerper, EMU2 antikoerper, Emu2 antikoerper, SH2B antikoerper, 9430032K24Rik antikoerper, BC002218 antikoerper, Col26a antikoerper, Emid2 antikoerper, collagen type XXVI alpha 1 chain antikoerper, collagen, type XXVI, alpha 1 antikoerper, COL26A1 antikoerper, Col26a1 antikoerper
- Hintergrund
- EMID2 contains 1 EMI domain and 2 collagen-like domains. The exact function of ZCCHC3 remains unknown.
- Molekulargewicht
- 45 kDa (MW of target protein)
-