ILDR1 Antikörper (Middle Region)

Produktnummer ABIN636101

Produktdetails anti-ILDR1 Antikörper

Target: ILDR1 (Immunoglobulin-Like Domain Containing Receptor 1 (ILDR1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ILDR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ILDR1 antibody was raised against the middle region of ILDR1

Aufreinigung: Affinity purified

Immunogen: ILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ILDR1 Blocking Peptide, catalog no. 33R-8140, is also available for use as a blocking control in assays to test for specificity of this ILDR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ILDR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ILDR1

Target: ILDR1 (Immunoglobulin-Like Domain Containing Receptor 1 (ILDR1))

Andere Bezeichnung: ILDR1 (ILDR1 Produkte)

Synonyme: DFNB42 antikoerper, ILDR1alpha antikoerper, ILDR1alpha' antikoerper, ILDR1beta antikoerper, AU041483 antikoerper, AU044638 antikoerper, RGD1307792 antikoerper, immunoglobulin like domain containing receptor 1 antikoerper, immunoglobulin-like domain containing receptor 1 antikoerper, immunoglobulin-like domain containing receptor 1 L homeolog antikoerper, ILDR1 antikoerper, Ildr1 antikoerper, ildr1.L antikoerper

Hintergrund: ILDR1 is a putative membrane receptor.

Molekulargewicht: 58 kDa (MW of target protein)