HTRA4 Antikörper (Middle Region)

Produktnummer ABIN636082

Produktdetails anti-HTRA4 Antikörper

Target: HTRA4 (HtrA Serine Peptidase 4 (HTRA4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HTRA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HTRA4 antibody was raised against the middle region of HTRA4

Aufreinigung: Affinity purified

Immunogen: HTRA4 antibody was raised using the middle region of HTRA4 corresponding to a region with amino acids LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HTRA4 Blocking Peptide, catalog no. 33R-5091, is also available for use as a blocking control in assays to test for specificity of this HTRA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTRA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HTRA4

Target: HTRA4 (HtrA Serine Peptidase 4 (HTRA4))

Andere Bezeichnung: HTRA4 (HTRA4 Produkte)

Synonyme: B430206E18Rik antikoerper, RGD1306242 antikoerper, HtrA serine peptidase 4 antikoerper, HTRA4 antikoerper, Htra4 antikoerper

Hintergrund: HTRA4 is a member of the HtrA family of proteases. The protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.

Molekulargewicht: 51 kDa (MW of target protein)