CYP20A1 Antikörper (N-Term)

Produktnummer ABIN636079

Produktdetails anti-CYP20A1 Antikörper

Target: CYP20A1 (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP20A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP20 A1 antibody was raised against the N terminal of CYP20 1

Aufreinigung: Affinity purified

Immunogen: CYP20 A1 antibody was raised using the N terminal of CYP20 1 corresponding to a region with amino acids ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP20A1 Blocking Peptide, catalog no. 33R-4185, is also available for use as a blocking control in assays to test for specificity of this CYP20A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP20A1

Target: CYP20A1 (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1))

Andere Bezeichnung: CYP20A1 (CYP20A1 Produkte)

Synonyme: CYP-M antikoerper, A930011N14Rik antikoerper, Cypm antikoerper, wu:fa10c06 antikoerper, zgc:63986 antikoerper, cyp-m antikoerper, cytochrome P450 family 20 subfamily A member 1 antikoerper, cytochrome P450, family 20, subfamily a, polypeptide 1 antikoerper, cytochrome P450, family 20, subfamily A, polypeptide 1 antikoerper, cytochrome P450 family 20 subfamily A member 1 L homeolog antikoerper, CYP20A1 antikoerper, Cyp20a1 antikoerper, cyp20a1 antikoerper, cyp20a1.L antikoerper

Hintergrund: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molekulargewicht: 52 kDa (MW of target protein)