CYP4B1 Antikörper (N-Term)

Produktnummer ABIN636076

Produktdetails anti-CYP4B1 Antikörper

Target: CYP4B1 (Cytochrome P450, Family 4, Subfamily B, Polypeptide 1 (CYP4B1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP4B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP4 B1 antibody was raised against the N terminal of CYP4 1

Aufreinigung: Affinity purified

Immunogen: CYP4 B1 antibody was raised using the N terminal of CYP4 1 corresponding to a region with amino acids SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP4B1 Blocking Peptide, catalog no. 33R-8937, is also available for use as a blocking control in assays to test for specificity of this CYP4B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP4B1

Target: CYP4B1 (Cytochrome P450, Family 4, Subfamily B, Polypeptide 1 (CYP4B1))

Andere Bezeichnung: CYP4B1 (CYP4B1 Produkte)

Synonyme: CYPIVB1 antikoerper, P-450HP antikoerper, cytochrome P450, family 4, subfamily B, polypeptide 1 antikoerper, CYP4B1-like isozyme short form antikoerper, cytochrome P450, family 4, subfamily B, polypeptide 1 L homeolog antikoerper, cytochrome P450 family 4 subfamily B member 1 antikoerper, cytochrome P450, family 4, subfamily b, polypeptide 1 antikoerper, cytochrome P450 family 4 subfamily B member 1 L homeolog antikoerper, CYP4B1 antikoerper, cyp4b1.L antikoerper, cyp4b1 antikoerper, Cyp4b1 antikoerper, cyp4b1.2.L antikoerper

Hintergrund: CYP4B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens, however, the specific function of the human protein has not been determined.

Molekulargewicht: 59 kDa (MW of target protein)