-
- Target Alle SLC27A5 Antikörper anzeigen
- SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC27A5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC27 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD
- Top Product
- Discover our top product SLC27A5 Primärantikörper
-
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (AA 508-570) antibody
SLC27A5 Reaktivität: Human, Maus, Affe WB, IHC, ELISA, FACS Wirt: Maus Monoclonal 4B11C10 unconjugated
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (Internal Region) antibodySLC27A5 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (AA 1-690) antibodySLC27A5 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (AA 90-175) antibodySLC27A5 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 5A7 unconjugated
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (AA 488-690) antibodySLC27A5 Reaktivität: Ratte WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (AA 90-175) antibodySLC27A5 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (AA 1-690) antibodySLC27A5 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (Center) antibodySLC27A5 Reaktivität: Human WB, IHC, IF, IC Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (AA 481-530) antibodySLC27A5 Reaktivität: Human WB, IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5) (Internal Region) antibodySLC27A5 Reaktivität: Human WB, IHC, ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC27A5 Blocking Peptide, catalog no. 33R-4549, is also available for use as a blocking control in assays to test for specificity of this SLC27A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5))
- Andere Bezeichnung
- SLC27A5 (SLC27A5 Produkte)
- Synonyme
- ACSB antikoerper, ACSVL6 antikoerper, BACS antikoerper, BAL antikoerper, FACVL3 antikoerper, FATP-5 antikoerper, FATP5 antikoerper, VLACSR antikoerper, VLCS-H2 antikoerper, VLCSH2 antikoerper, Vlacsr antikoerper, rBAL-1 antikoerper, SLC27A5 antikoerper, solute carrier family 27 member 5 antikoerper, solute carrier family 27 (fatty acid transporter), member 5 antikoerper, bile acyl-CoA synthetase antikoerper, SLC27A5 antikoerper, Slc27a5 antikoerper, LOC608675 antikoerper, LOC100450572 antikoerper
- Hintergrund
- The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons.
- Molekulargewicht
- 75 kDa (MW of target protein)
-
Sie sind hier:
