CTRB1 Antikörper (Middle Region)
-
- Target Alle CTRB1 Antikörper anzeigen
- CTRB1 (Chymotrypsinogen B1 (CTRB1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CTRB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Chymotrypsinogen B1 antibody was raised against the middle region of CTRB1
- Aufreinigung
- Affinity purified
- Immunogen
- Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
- Top Product
- Discover our top product CTRB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Chymotrypsinogen B1 Blocking Peptide, catalog no. 33R-9835, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsinogen B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CTRB1 (Chymotrypsinogen B1 (CTRB1))
- Andere Bezeichnung
- Chymotrypsinogen B1 (CTRB1 Produkte)
- Synonyme
- wu:fb61f07 antikoerper, wu:fb69e12 antikoerper, CTRB1 antikoerper, 2200008D09Rik antikoerper, AI504462 antikoerper, Ctrb antikoerper, Prt-2 antikoerper, CTRB antikoerper, ctrb antikoerper, ctrb2 antikoerper, chymotrypsinogen B1 antikoerper, chymotrypsinogen B antikoerper, chymostrypsinogen B1-like antikoerper, chymotrypsinogen B1 L homeolog antikoerper, CTRB1 antikoerper, ctrb1 antikoerper, LOC618826 antikoerper, LOC713851 antikoerper, LOC479649 antikoerper, Ctrb1 antikoerper, ctrb1.L antikoerper, LOC102150576 antikoerper
- Hintergrund
- Alpha-chymotrypsin (EC 3.4.21.1) is one of a family of serine proteases secreted into the gastrointestinal tract as the inactive precursor chymotrypsinogen. The zymogen is activated by proteolytic cleavage by trypsin.
- Molekulargewicht
- 28 kDa (MW of target protein)
-