TMPRSS12 Antikörper (Middle Region)

Produktnummer ABIN636063

Produktdetails anti-TMPRSS12 Antikörper

Target: TMPRSS12 (Transmembrane (C-terminal) Protease, serine 12 (TMPRSS12))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMPRSS12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMPRSS12 antibody was raised against the middle region of TMPRSS12

Aufreinigung: Affinity purified

Immunogen: TMPRSS12 antibody was raised using the middle region of TMPRSS12 corresponding to a region with amino acids KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMPRSS12 Blocking Peptide, catalog no. 33R-4324, is also available for use as a blocking control in assays to test for specificity of this TMPRSS12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMPRSS12

Target: TMPRSS12 (Transmembrane (C-terminal) Protease, serine 12 (TMPRSS12))

Andere Bezeichnung: TMPRSS12 (TMPRSS12 Produkte)

Synonyme: 4930478A21Rik antikoerper, transmembrane protease, serine 12 antikoerper, transmembrane (C-terminal) protease, serine 12 antikoerper, TMPRSS12 antikoerper, tmprss12 antikoerper, Tmprss12 antikoerper

Hintergrund: TMPRSS12 belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme.

Molekulargewicht: 38 kDa (MW of target protein)