Arylsulfatase E Antikörper

Produktnummer ABIN636061

Produktdetails anti-Arylsulfatase E Antikörper

Target: Arylsulfatase E (ARSE)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Arylsulfatase E Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ARSE antibody was raised using a synthetic peptide corresponding to a region with amino acids KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARSE Blocking Peptide, catalog no. 33R-4727, is also available for use as a blocking control in assays to test for specificity of this ARSE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Arylsulfatase E

Target: Arylsulfatase E (ARSE)

Andere Bezeichnung: ARSE (ARSE Produkte)

Synonyme: ASE antikoerper, CDPX antikoerper, CDPX1 antikoerper, CDPXR antikoerper, ARSE antikoerper, MGC155058 antikoerper, arylsulfatase E (chondrodysplasia punctata 1) antikoerper, arylsulfatase E antikoerper, ARSE antikoerper, Arse antikoerper

Hintergrund: Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.

Molekulargewicht: 62 kDa (MW of target protein)