CRISPLD2 Antikörper (N-Term)
-
- Target Alle CRISPLD2 Antikörper anzeigen
- CRISPLD2 (Cysteine-Rich Secretory Protein LCCL Domain Containing 2 (CRISPLD2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRISPLD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CRISPLD2 antibody was raised against the N terminal of CRISPLD2
- Aufreinigung
- Affinity purified
- Immunogen
- CRISPLD2 antibody was raised using the N terminal of CRISPLD2 corresponding to a region with amino acids MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA
- Top Product
- Discover our top product CRISPLD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CRISPLD2 Blocking Peptide, catalog no. 33R-6404, is also available for use as a blocking control in assays to test for specificity of this CRISPLD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRISPLD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRISPLD2 (Cysteine-Rich Secretory Protein LCCL Domain Containing 2 (CRISPLD2))
- Andere Bezeichnung
- CRISPLD2 (CRISPLD2 Produkte)
- Synonyme
- MGC107747 antikoerper, CRISP11 antikoerper, LCRISP2 antikoerper, 1810049K24Rik antikoerper, Lcrisp2 antikoerper, Lgl1 antikoerper, coffeecrisp antikoerper, cysteine rich secretory protein LCCL domain containing 2 antikoerper, cysteine-rich secretory protein LCCL domain containing 2 antikoerper, CRISPLD2 antikoerper, crispld2 antikoerper, Crispld2 antikoerper
- Hintergrund
- CRISPLD2 is a novel NSCLP candidate gene.
- Molekulargewicht
- 56 kDa (MW of target protein)
-