A4GALT Antikörper

Produktnummer ABIN635990

Produktdetails anti-A4GALT Antikörper

Target: A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser A4GALT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: A4 GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

A4GALT Blocking Peptide, catalog no. 33R-9678, is also available for use as a blocking control in assays to test for specificity of this A4GALT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 ALT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu A4GALT

Target: A4GALT (alpha 1, 4-Galactosyltransferase (A4GALT))

Andere Bezeichnung: A4GALT (A4GALT Produkte)

Synonyme: A14GALT antikoerper, A4GALT1 antikoerper, Gb3S antikoerper, P(k) antikoerper, P1 antikoerper, P1PK antikoerper, PK antikoerper, Gb3 antikoerper, alpha 1,4-galactosyltransferase (P blood group) antikoerper, alpha 1,4-galactosyltransferase antikoerper, A4GALT antikoerper, A4galt antikoerper

Hintergrund: The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system.

Molekulargewicht: 40 kDa (MW of target protein)