GCNT4 Antikörper
-
- Target Alle GCNT4 Antikörper anzeigen
- GCNT4 (Glucosaminyl (N-Acetyl) Transferase 4, Core 2 (Beta-1,6-N-Acetylglucosaminyltransferase) (GCNT4))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GCNT4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GCNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF
- Top Product
- Discover our top product GCNT4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GCNT4 Blocking Peptide, catalog no. 33R-8548, is also available for use as a blocking control in assays to test for specificity of this GCNT4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCNT4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCNT4 (Glucosaminyl (N-Acetyl) Transferase 4, Core 2 (Beta-1,6-N-Acetylglucosaminyltransferase) (GCNT4))
- Andere Bezeichnung
- GCNT4 (GCNT4 Produkte)
- Synonyme
- C2GNT3 antikoerper, C2gnt3 antikoerper, Gm279 antikoerper, Gm73 antikoerper, c2gnt3 antikoerper, gcnt4 antikoerper, wu:fc31c11 antikoerper, glucosaminyl (N-acetyl) transferase 4, core 2 antikoerper, glucosaminyl (N-acetyl) transferase 4, core 2 (beta-1,6-N-acetylglucosaminyltransferase) antikoerper, glucosaminyl (N-acetyl) transferase 4, core 2, a antikoerper, GCNT4 antikoerper, Gcnt4 antikoerper, gcnt4a antikoerper
- Hintergrund
- GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity.
- Molekulargewicht
- 53 kDa (MW of target protein)
-