IL1RL1 Antikörper (N-Term)

Produktnummer ABIN635984

Produktdetails anti-IL1RL1 Antikörper

Target: IL1RL1 (Interleukin 1 Receptor-Like 1 (IL1RL1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL1RL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IL1 RL1 antibody was raised against the N terminal of IL1 L1

Aufreinigung: Affinity purified

Immunogen: IL1 RL1 antibody was raised using the N terminal of IL1 L1 corresponding to a region with amino acids RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL1RL1 Blocking Peptide, catalog no. 33R-8118, is also available for use as a blocking control in assays to test for specificity of this IL1RL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 L1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL1RL1

Target: IL1RL1 (Interleukin 1 Receptor-Like 1 (IL1RL1))

Andere Bezeichnung: IL1RL1 (IL1RL1 Produkte)

Synonyme: DER4 antikoerper, Fit-1 antikoerper, Ly84 antikoerper, ST2L antikoerper, St2 antikoerper, St2-rs1 antikoerper, T1 antikoerper, T1/ST2 antikoerper, FIT-1 antikoerper, IL33R antikoerper, ST2 antikoerper, ST2V antikoerper, FIT1 antikoerper, interleukin 1 receptor-like 1 antikoerper, interleukin 1 receptor like 1 antikoerper, Il1rl1 antikoerper, IL1RL1 antikoerper

Hintergrund: IL1RL1 is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants.

Molekulargewicht: 61 kDa (MW of target protein)