TMX2 Antikörper (Middle Region)

Produktnummer ABIN635980

Produktdetails anti-TMX2 Antikörper

Target: TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TXNDC14 antibody was raised against the middle region of TXNDC14

Aufreinigung: Affinity purified

Immunogen: TXNDC14 antibody was raised using the middle region of TXNDC14 corresponding to a region with amino acids IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TXNDC14 Blocking Peptide, catalog no. 33R-4138, is also available for use as a blocking control in assays to test for specificity of this TXNDC14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMX2

Target: TMX2 (Thioredoxin-Related Transmembrane Protein 2 (TMX2))

Andere Bezeichnung: TXNDC14 (TMX2 Produkte)

Synonyme: PDIA12 antikoerper, PIG26 antikoerper, TXNDC14 antikoerper, 2310042M24Rik antikoerper, AA589631 antikoerper, Txndc14 antikoerper, tmx2 antikoerper, txndc14 antikoerper, wu:fb73h06 antikoerper, zgc:86830 antikoerper, pig26 antikoerper, cgi-31 antikoerper, MGC79568 antikoerper, DKFZp469G2332 antikoerper, im:7138651 antikoerper, zgc:172264 antikoerper, thioredoxin related transmembrane protein 2 antikoerper, thioredoxin-related transmembrane protein 2 antikoerper, thioredoxin-related transmembrane protein 2b antikoerper, thioredoxin domain containing 14 antikoerper, thioredoxin related transmembrane protein 2 S homeolog antikoerper, thioredoxin-related transmembrane protein 2a antikoerper, TMX2 antikoerper, Tmx2 antikoerper, tmx2b antikoerper, tmx2 antikoerper, CpipJ_CPIJ000873 antikoerper, tmx2.S antikoerper, tmx2a antikoerper

Hintergrund: The function of TXNDC14 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 34 kDa (MW of target protein)