DNAJB9 Antikörper

Produktnummer ABIN635974

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch DNAJB9 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für DNAJB9 Antikörper (ABIN635974)

Target: DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJB9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DNAJB9 Antikörper

Aufreinigung: Affinity purified

Immunogen: DNAJB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNAJB9 Blocking Peptide, (ABIN5613231), is also available for use as a blocking control in assays to test for specificity of this DNAJB9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJB9

Target: DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))

Andere Bezeichnung: DNAJB9

Hintergrund: DNAJB9 acts as a co-chaperone with an Hsp70 protein.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling