DNAJB9 Antikörper
-
- Target Alle DNAJB9 Antikörper anzeigen
- DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNAJB9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DNAJB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA
- Top Product
- Discover our top product DNAJB9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNAJB9 Blocking Peptide, catalog no. 33R-5786, is also available for use as a blocking control in assays to test for specificity of this DNAJB9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))
- Andere Bezeichnung
- DNAJB9 (DNAJB9 Produkte)
- Synonyme
- ERdj4 antikoerper, MDG-1 antikoerper, MDG1 antikoerper, MST049 antikoerper, MSTP049 antikoerper, AA408011 antikoerper, AA673251 antikoerper, AA673481 antikoerper, AW556981 antikoerper, Mdg1 antikoerper, mDj7 antikoerper, DnaJ heat shock protein family (Hsp40) member B9 antikoerper, DNAJB9 antikoerper, Dnajb9 antikoerper
- Hintergrund
- DNAJB9 acts as a co-chaperone with an Hsp70 protein.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-