GZMK Antikörper

Produktnummer ABIN635952

Produktdetails anti-GZMK Antikörper

Target: GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GZMK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Granzyme K Blocking Peptide, catalog no. 33R-5391, is also available for use as a blocking control in assays to test for specificity of this Granzyme K antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GZMK

Target: GZMK (Granzyme K (Granzyme 3, Tryptase II) (GZMK))

Andere Bezeichnung: Granzyme K (GZMK Produkte)

Synonyme: TRYP2 antikoerper, granzyme K antikoerper, GZMK antikoerper, Gzmk antikoerper

Hintergrund: GZMK is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells.

Molekulargewicht: 26 kDa (MW of target protein)