LRP8 Antikörper (Middle Region)

Produktnummer ABIN635949

Produktdetails anti-LRP8 Antikörper

Target: LRP8 (Low Density Lipoprotein Receptor-Related Protein 8, Apolipoprotein E Receptor (LRP8))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRP8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRP8 antibody was raised against the middle region of LRP8

Aufreinigung: Affinity purified

Immunogen: LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRP8 Blocking Peptide, catalog no. 33R-1575, is also available for use as a blocking control in assays to test for specificity of this LRP8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRP8

Target: LRP8 (Low Density Lipoprotein Receptor-Related Protein 8, Apolipoprotein E Receptor (LRP8))

Andere Bezeichnung: LRP8 (LRP8 Produkte)

Synonyme: LRP8 antikoerper, APOER2 antikoerper, HSZ75190 antikoerper, LRP-8 antikoerper, MCI1 antikoerper, 4932703M08Rik antikoerper, AA921429 antikoerper, AI848122 antikoerper, ApoER2 antikoerper, Lr8b antikoerper, LR8B antikoerper, LDL receptor related protein 8 antikoerper, low density lipoprotein receptor-related protein 8, apolipoprotein e receptor antikoerper, LRP8 antikoerper, Lrp8 antikoerper

Hintergrund: LRP8 is an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL).

Molekulargewicht: 74 kDa (MW of target protein)