SLC22A12 Antikörper
-
- Target Alle SLC22A12 Antikörper anzeigen
- SLC22A12 (Solute Carrier Family 22 (Organic Anion/urate Transporter), Member 12 (SLC22A12))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC22 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR
- Top Product
- Discover our top product SLC22A12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC22A12 Blocking Peptide, catalog no. 33R-8641, is also available for use as a blocking control in assays to test for specificity of this SLC22A12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A12 (Solute Carrier Family 22 (Organic Anion/urate Transporter), Member 12 (SLC22A12))
- Andere Bezeichnung
- SLC22A12 (SLC22A12 Produkte)
- Synonyme
- AI987855 antikoerper, OAT4L antikoerper, Rst antikoerper, Slc22al2 antikoerper, URAT1 antikoerper, RST antikoerper, solute carrier family 22 (organic anion/cation transporter), member 12 antikoerper, solute carrier family 22 member 12 antikoerper, Slc22a12 antikoerper, SLC22A12 antikoerper
- Hintergrund
- SLC22A12 is required for efficient urate re-absorption in the kidney. SLC22A12 regulates blood urate levels. SLC22A12 mediates saturable urate uptake by facilitating the exchange of urate against organic anions.
- Molekulargewicht
- 59 kDa (MW of target protein)
-