SLC30A1 Antikörper

Produktnummer ABIN635943

Produktdetails anti-SLC30A1 Antikörper

Target: SLC30A1 (Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC30A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC30 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC30A1 Blocking Peptide, catalog no. 33R-2860, is also available for use as a blocking control in assays to test for specificity of this SLC30A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC30A1

Target: SLC30A1 (Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1))

Andere Bezeichnung: SLC30A1 (SLC30A1 Produkte)

Synonyme: ZNT1 antikoerper, ZRC1 antikoerper, AI839647 antikoerper, C130040I11Rik antikoerper, Znt1 antikoerper, ZnT1 antikoerper, slc30 antikoerper, MGC53047 antikoerper, XZnSLC30 antikoerper, slc30a1 antikoerper, zgc:77589 antikoerper, zrc1 antikoerper, ZnT-1 antikoerper, ZNT8 antikoerper, ZnT-8 antikoerper, zinc transporter 1 precursor antikoerper, RGD1305098 antikoerper, zgc:162909 antikoerper, znt1 antikoerper, solute carrier family 30 member 1 antikoerper, solute carrier family 30 (zinc transporter), member 1 antikoerper, solute carrier family 30 member 1 L homeolog antikoerper, solute carrier family 30 (zinc transporter), member 1a antikoerper, solute carrier family 30 member 8 antikoerper, zinc transporter 1 precursor antikoerper, solute carrier family 30, member 10 antikoerper, solute carrier family 30 (zinc transporter), member 1b antikoerper, SLC30A1 antikoerper, Slc30a1 antikoerper, slc30a1.L antikoerper, slc30a1a antikoerper, slc30a1 antikoerper, SLC30A8 antikoerper, ZIP1 antikoerper, Slc30a10 antikoerper, slc30a1b antikoerper

Hintergrund: SLC30A1 may be involved in zinc transport out of the cell.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis