SLC30A1 Antikörper
-
- Target Alle SLC30A1 Antikörper anzeigen
- SLC30A1 (Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC30A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC30 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY
- Top Product
- Discover our top product SLC30A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC30A1 Blocking Peptide, catalog no. 33R-2860, is also available for use as a blocking control in assays to test for specificity of this SLC30A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC30A1 (Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1))
- Andere Bezeichnung
- SLC30A1 (SLC30A1 Produkte)
- Synonyme
- ZNT1 antikoerper, ZRC1 antikoerper, AI839647 antikoerper, C130040I11Rik antikoerper, Znt1 antikoerper, ZnT1 antikoerper, slc30 antikoerper, MGC53047 antikoerper, XZnSLC30 antikoerper, slc30a1 antikoerper, zgc:77589 antikoerper, zrc1 antikoerper, ZnT-1 antikoerper, ZNT8 antikoerper, ZnT-8 antikoerper, zinc transporter 1 precursor antikoerper, RGD1305098 antikoerper, zgc:162909 antikoerper, znt1 antikoerper, solute carrier family 30 member 1 antikoerper, solute carrier family 30 (zinc transporter), member 1 antikoerper, solute carrier family 30 member 1 L homeolog antikoerper, solute carrier family 30 (zinc transporter), member 1a antikoerper, solute carrier family 30 member 8 antikoerper, zinc transporter 1 precursor antikoerper, solute carrier family 30, member 10 antikoerper, solute carrier family 30 (zinc transporter), member 1b antikoerper, SLC30A1 antikoerper, Slc30a1 antikoerper, slc30a1.L antikoerper, slc30a1a antikoerper, slc30a1 antikoerper, SLC30A8 antikoerper, ZIP1 antikoerper, Slc30a10 antikoerper, slc30a1b antikoerper
- Hintergrund
- SLC30A1 may be involved in zinc transport out of the cell.
- Molekulargewicht
- 55 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-