SLC22A13 Antikörper (N-Term)

Produktnummer ABIN635939

Produktdetails anti-SLC22A13 Antikörper

Target: SLC22A13 (Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC22 A13 antibody was raised against the N terminal of SLC22 13

Aufreinigung: Affinity purified

Immunogen: SLC22 A13 antibody was raised using the N terminal of SLC22 13 corresponding to a region with amino acids FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A13 Blocking Peptide, catalog no. 33R-2884, is also available for use as a blocking control in assays to test for specificity of this SLC22A13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A13

Target: SLC22A13 (Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13))

Andere Bezeichnung: SLC22A13 (SLC22A13 Produkte)

Synonyme: OAT10 antikoerper, OCTL1 antikoerper, OCTL3 antikoerper, ORCTL-3 antikoerper, ORCTL3 antikoerper, AI648912 antikoerper, solute carrier family 22 member 13 antikoerper, solute carrier family 22 (organic cation transporter), member 13 antikoerper, SLC22A13 antikoerper, Slc22a13 antikoerper

Hintergrund: SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.

Molekulargewicht: 61 kDa (MW of target protein)