SLC1A1 Antikörper (N-Term)
-
- Target Alle SLC1A1 Antikörper anzeigen
- SLC1A1 (Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC1A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC1 A1 antibody was raised against the N terminal Of Slc1 1
- Aufreinigung
- Affinity purified
- Immunogen
- SLC1 A1 antibody was raised using the N terminal Of Slc1 1 corresponding to a region with amino acids VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN
- Top Product
- Discover our top product SLC1A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC1A1 Blocking Peptide, catalog no. 33R-9692, is also available for use as a blocking control in assays to test for specificity of this SLC1A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC1A1 (Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1 (SLC1A1))
- Andere Bezeichnung
- SLC1A1 (SLC1A1 Produkte)
- Synonyme
- GB16911 antikoerper, EAAT3 antikoerper, SLC1A2a antikoerper, zgc:91959 antikoerper, EAAC1 antikoerper, SCZD18 antikoerper, D130048G10Rik antikoerper, EAAC2 antikoerper, MEAAC1 antikoerper, Eaac1 antikoerper, Eaat3 antikoerper, REAAC1 antikoerper, excitatory amino acid transporter 3 antikoerper, solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1 antikoerper, solute carrier family 1 member 1 antikoerper, LOC412382 antikoerper, slc1a1 antikoerper, SLC1A1 antikoerper, CpipJ_CPIJ000674 antikoerper, CpipJ_CPIJ001134 antikoerper, Slc1a1 antikoerper
- Hintergrund
- SLC1A1 transports L-glutamate and also L- and D-aspartate. It is essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. SLC1A1 acts as a symport by cotransporting sodium. It negatively regulated by ARL6IP5.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-