SLC13A2 Antikörper
-
- Target Alle SLC13A2 Antikörper anzeigen
- SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC13A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC13 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD
- Top Product
- Discover our top product SLC13A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC13A2 Blocking Peptide, catalog no. 33R-7231, is also available for use as a blocking control in assays to test for specificity of this SLC13A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))
- Andere Bezeichnung
- SLC13A2 (SLC13A2 Produkte)
- Synonyme
- NADC1 antikoerper, NaCT antikoerper, NaDC-1 antikoerper, SDCT1 antikoerper, Nadc1 antikoerper, mucin antikoerper, mNaDC-1 antikoerper, INDY antikoerper, nact antikoerper, slc13a2 antikoerper, slc13a5 antikoerper, wu:fd51b01 antikoerper, wu:fi13d08 antikoerper, wu:fi31b05 antikoerper, zgc:55601 antikoerper, zgc:77607 antikoerper, solute carrier family 13 member 2 antikoerper, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 antikoerper, solute carrier family 13 member 5 L homeolog antikoerper, SLC13A2 antikoerper, Slc13a2 antikoerper, slc13a5.L antikoerper, slc13a2 antikoerper
- Hintergrund
- SLC13A2 belongs to the SLC13A transporter family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.
- Molekulargewicht
- 64 kDa (MW of target protein)
-