MBOAT7 Antikörper (C-Term)

Produktnummer ABIN635931

Produktdetails anti-MBOAT7 Antikörper

Target: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBOAT7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LENG4 antibody was raised against the C terminal Of Leng4

Aufreinigung: Affinity purified

Immunogen: LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LENG4 Blocking Peptide, catalog no. 33R-10038, is also available for use as a blocking control in assays to test for specificity of this LENG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LENG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBOAT7

Target: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Andere Bezeichnung: LENG4 (MBOAT7 Produkte)

Synonyme: BB1 antikoerper, LENG4 antikoerper, LPIAT antikoerper, LRC4 antikoerper, MBOA7 antikoerper, OACT7 antikoerper, hMBOA-7 antikoerper, 5730589L02Rik antikoerper, Leng4 antikoerper, Lpiat antikoerper, mBB1 antikoerper, RGD1306945 antikoerper, membrane bound O-acyltransferase domain containing 7 antikoerper, Lysophospholipid acyltransferase 7 antikoerper, MBOAT7 antikoerper, Mboat7 antikoerper, mboa-7 antikoerper

Hintergrund: MBOAT7 belongs to the membrane-bound acyltransferase family. It is involved in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Inositol Metabolic Process