MBOAT7 Antikörper (C-Term)
-
- Target Alle MBOAT7 Antikörper anzeigen
- MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MBOAT7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LENG4 antibody was raised against the C terminal Of Leng4
- Aufreinigung
- Affinity purified
- Immunogen
- LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA
- Top Product
- Discover our top product MBOAT7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LENG4 Blocking Peptide, catalog no. 33R-10038, is also available for use as a blocking control in assays to test for specificity of this LENG4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LENG4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))
- Andere Bezeichnung
- LENG4 (MBOAT7 Produkte)
- Synonyme
- BB1 antikoerper, LENG4 antikoerper, LPIAT antikoerper, LRC4 antikoerper, MBOA7 antikoerper, OACT7 antikoerper, hMBOA-7 antikoerper, 5730589L02Rik antikoerper, Leng4 antikoerper, Lpiat antikoerper, mBB1 antikoerper, RGD1306945 antikoerper, membrane bound O-acyltransferase domain containing 7 antikoerper, Lysophospholipid acyltransferase 7 antikoerper, MBOAT7 antikoerper, Mboat7 antikoerper, mboa-7 antikoerper
- Hintergrund
- MBOAT7 belongs to the membrane-bound acyltransferase family. It is involved in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils.
- Molekulargewicht
- 53 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-