ZMPSTE24 Antikörper

Produktnummer ABIN635915

Produktdetails anti-ZMPSTE24 Antikörper

Target: ZMPSTE24 (Zmpste24) (Zinc Metalloproteinase, Ste24 (Zmpste24))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZMPSTE24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ZMPSTE24 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZMPSTE24 Blocking Peptide, catalog no. 33R-5572, is also available for use as a blocking control in assays to test for specificity of this ZMPSTE24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZMPSTE24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZMPSTE24

Target: ZMPSTE24 (Zmpste24) (Zinc Metalloproteinase, Ste24 (Zmpste24))

Andere Bezeichnung: ZMPSTE24 (Zmpste24 Produkte)

Synonyme: DDBDRAFT_0189115 antikoerper, DDBDRAFT_0237846 antikoerper, DDB_0189115 antikoerper, DDB_0237846 antikoerper, F2N1.21 antikoerper, F2N1_21 antikoerper, STE24 antikoerper, FACE-1 antikoerper, FACE1 antikoerper, HGPS antikoerper, PRO1 antikoerper, Ste24p antikoerper, A530043O15Rik antikoerper, D030046F19 antikoerper, Face-1 antikoerper, MADB antikoerper, fi45a02 antikoerper, wu:fi45a02 antikoerper, zgc:55655 antikoerper, zinc metallopeptidase STE24 antikoerper, zinc metallopeptidase STE24 L homeolog antikoerper, CAAX prenyl protease antikoerper, Peptidase family M48 family protein antikoerper, zinc metallopeptidase, STE24 antikoerper, zinc metallopeptidase, STE24 homolog antikoerper, ZMPSTE24 antikoerper, zmpste24.L antikoerper, zmpste24 antikoerper, ATSTE24 antikoerper, Zmpste24 antikoerper

Hintergrund: ZMPSTE24 is a member of the peptidase M48A family. This protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in ZMPSTE24 gene have been associated with mandibuloacral dysplasia and restrictive dermopathy.

Molekulargewicht: 55 kDa (MW of target protein)