B4GALT3 Antikörper (Middle Region)

Produktnummer ABIN635885

Produktdetails anti-B4GALT3 Antikörper

Target: B4GALT3 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B4GALT3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: B4 GALT3 antibody was raised against the middle region of B4 ALT3

Aufreinigung: Affinity purified

Immunogen: B4 GALT3 antibody was raised using the middle region of B4 ALT3 corresponding to a region with amino acids MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B4GALT3 Blocking Peptide, catalog no. 33R-6588, is also available for use as a blocking control in assays to test for specificity of this B4GALT3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B4GALT3

Target: B4GALT3 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3))

Andere Bezeichnung: B4GALT3 (B4GALT3 Produkte)

Synonyme: beta4Gal-T3 antikoerper, 9530061M23Rik antikoerper, AA104562 antikoerper, AW125175 antikoerper, ESTM26 antikoerper, ESTM6 antikoerper, R74981 antikoerper, b4Gal-T3 antikoerper, beta-1,4-galactosyltransferase 3 antikoerper, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 S homeolog antikoerper, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 3 antikoerper, B4GALT3 antikoerper, b4galt3.S antikoerper, B4galt3 antikoerper

Hintergrund: This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose, all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process