IGLL1 Antikörper (N-Term)

Produktnummer ABIN635874

Produktdetails anti-IGLL1 Antikörper

Target: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGLL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIGO antibody was raised against the N terminal of PIGO

Aufreinigung: Affinity purified

Immunogen: PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGO Blocking Peptide, catalog no. 33R-5039, is also available for use as a blocking control in assays to test for specificity of this PIGO antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGO antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGLL1

Target: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Andere Bezeichnung: IGO (IGLL1 Produkte)

Synonyme: 14.1 antikoerper, AGM2 antikoerper, CD179b antikoerper, IGL1 antikoerper, IGL5 antikoerper, IGLJ14.1 antikoerper, IGLL antikoerper, IGO antikoerper, IGVPB antikoerper, VPREB2 antikoerper, IGLV antikoerper, IGLL1 antikoerper, MGC151892 antikoerper, Igll1 antikoerper, BB139905 antikoerper, Igl-5 antikoerper, Igll antikoerper, Lambda5 antikoerper, immunoglobulin lambda like polypeptide 1 antikoerper, immunoglobulin lambda-like polypeptide 1 antikoerper, IGLL1 antikoerper, Igll1 antikoerper

Hintergrund: PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.

Molekulargewicht: 74 kDa (MW of target protein)

Pathways: Regulation of Cell Size