AOC2 Antikörper
-
- Target Alle AOC2 Antikörper anzeigen
- AOC2 (Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AOC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids AEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSIN
- Top Product
- Discover our top product AOC2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AOC2 Blocking Peptide (retina specific), catalog no. 33R-1119, is also available for use as a blocking control in assays to test for specificity of this AOC2 antibody (retina specific)
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AOC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AOC2 (Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2))
- Andere Bezeichnung
- AOC2 (AOC2 Produkte)
- Synonyme
- DAO2 antikoerper, RAO antikoerper, AOC2 antikoerper, AOC3 antikoerper, aoc3 antikoerper, wu:fa94a08 antikoerper, wu:fe14c05 antikoerper, zgc:113006 antikoerper, amine oxidase, copper containing 2 antikoerper, amine oxidase, copper containing 2 (retina-specific) antikoerper, membrane primary amine oxidase-like antikoerper, retina-specific copper amine oxidase antikoerper, AOC2 antikoerper, Aoc2 antikoerper, LOC100353051 antikoerper, aoc2 antikoerper
- Hintergrund
- Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine.
- Molekulargewicht
- 84 kDa (MW of target protein)
-