GPAA1 Antikörper

Produktnummer ABIN635865

Produktdetails anti-GPAA1 Antikörper

Target: GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPAA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: GPAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPAA1 Blocking Peptide, catalog no. 33R-4996, is also available for use as a blocking control in assays to test for specificity of this GPAA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPAA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPAA1

Target: GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))

Andere Bezeichnung: GPAA1 (GPAA1 Produkte)

Synonyme: GAA1 antikoerper, hGAA1 antikoerper, C80044 antikoerper, mGAA1 antikoerper, glycosylphosphatidylinositol anchor attachment 1 antikoerper, GPI anchor attachment protein 1 antikoerper, GPAA1 antikoerper, Gpaa1 antikoerper

Hintergrund: Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, Maintenance of Protein Location, SARS-CoV-2 Protein Interaktom