ADAM30 Antikörper (N-Term)
-
- Target Alle ADAM30 Antikörper anzeigen
- ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAM30 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ADAM30 antibody was raised against the N terminal of ADAM30
- Aufreinigung
- Affinity purified
- Immunogen
- ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH
- Top Product
- Discover our top product ADAM30 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADAM30 Blocking Peptide, catalog no. 33R-3955, is also available for use as a blocking control in assays to test for specificity of this ADAM30 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAM30 (ADAM Metallopeptidase Domain 30 (ADAM30))
- Andere Bezeichnung
- ADAM30 (ADAM30 Produkte)
- Synonyme
- svph4 antikoerper, 4933424D07Rik antikoerper, ADAM metallopeptidase domain 30 antikoerper, a disintegrin and metallopeptidase domain 30 antikoerper, ADAM30 antikoerper, Adam30 antikoerper
- Hintergrund
- ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins.
- Molekulargewicht
- 66 kDa (MW of target protein)
-