Tspan-8 Antikörper (Middle Region)

Produktnummer ABIN635820

Produktdetails anti-Tspan-8 Antikörper

Target: Tspan-8 (TSPAN8) (Tetraspanin 8 (TSPAN8))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Tspan-8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Tetraspanin 8 antibody was raised against the middle region of TSPAN8

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 8 antibody was raised using the middle region of TSPAN8 corresponding to a region with amino acids VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 8 Blocking Peptide, catalog no. 33R-9530, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Tspan-8

Target: Tspan-8 (TSPAN8) (Tetraspanin 8 (TSPAN8))

Andere Bezeichnung: Tetraspanin 8 (TSPAN8 Produkte)

Synonyme: tm4sf3 antikoerper, MGC64550 antikoerper, GB13255 antikoerper, TM4SF3 antikoerper, tetraspanin-8 antikoerper, tspan8 antikoerper, TSPAN8 antikoerper, CO-029 antikoerper, C76990 antikoerper, E330007O21Rik antikoerper, Tm4sf3 antikoerper, CO-29 antikoerper, TSPAN-8 antikoerper, tetraspanin 8 L homeolog antikoerper, tetraspanin-1 antikoerper, tetraspanin 8 antikoerper, tspan8.L antikoerper, LOC409511 antikoerper, TSPAN8 antikoerper, tspan8 antikoerper, Tspan8 antikoerper

Hintergrund: TSPAN8 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN8 is a cell surface glycoprotein that is known to complex with integrins. TSPAN8 is expressed in different carcinomas.

Molekulargewicht: 26 kDa (MW of target protein)