CHST1 Antikörper

Produktnummer ABIN635810

Der Kaninchen Polyklonal anti-CHST1 Antikörper wird verwendet zum Nachweis von CHST1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für CHST1 Antikörper (ABIN635810)

Target: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHST1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHST1 Antikörper

Aufreinigung: Affinity purified

Immunogen: CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHST1 Blocking Peptide, (ABIN936201), is also available for use as a blocking control in assays to test for specificity of this CHST1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHST1

Target: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Andere Bezeichnung: CHST1

Hintergrund: CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process