CHST1 Antikörper

Produktnummer ABIN635810

Produktdetails anti-CHST1 Antikörper

Target: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHST1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHST1 Blocking Peptide, catalog no. 33R-10227, is also available for use as a blocking control in assays to test for specificity of this CHST1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHST1

Target: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Andere Bezeichnung: CHST1 (CHST1 Produkte)

Synonyme: C6ST antikoerper, GST-1 antikoerper, KS6ST antikoerper, KSGal6ST antikoerper, KSST antikoerper, sulfo1 antikoerper, 2610008E20Rik antikoerper, AW125896 antikoerper, Gst1 antikoerper, KSGAL6ST antikoerper, carbohydrate sulfotransferase 1 antikoerper, carbohydrate (keratan sulfate Gal-6) sulfotransferase 1 antikoerper, CHST1 antikoerper, Chst1 antikoerper

Hintergrund: CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process