UQCR10 Antikörper

Produktnummer ABIN635794

Produktdetails anti-UQCR10 Antikörper

Target: UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UQCR10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UCRC Blocking Peptide, catalog no. 33R-4946, is also available for use as a blocking control in assays to test for specificity of this UCRC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCRC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UQCR10

Target: UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))

Andere Bezeichnung: UCRC (UQCR10 Produkte)

Synonyme: Ucrc antikoerper, UCRC antikoerper, qcr9 antikoerper, ucrc antikoerper, HSPC051 antikoerper, HSPC151 antikoerper, QCR9 antikoerper, UCCR7.2 antikoerper, 1110020P15Rik antikoerper, AA960494 antikoerper, ubiquinol-cytochrome c reductase, complex III subunit X antikoerper, ubiquinol-cytochrome c reductase complex 7.2 kDa protein antikoerper, ubiquinol-cytochrome c reductase, complex III subunit X L homeolog antikoerper, Uqcr10 antikoerper, UQCR10 antikoerper, uqcr10.L antikoerper

Hintergrund: UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.

Molekulargewicht: 7 kDa (MW of target protein)