ChT Antikörper

Produktnummer ABIN635784

Produktdetails anti-ChT Antikörper

Target: ChT (High Affinity Choline Transporter (ChT))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ChT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC5 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC5A7 Blocking Peptide, catalog no. 33R-1884, is also available for use as a blocking control in assays to test for specificity of this SLC5A7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ChT

Target: ChT (High Affinity Choline Transporter (ChT))

Andere Bezeichnung: SLC5A7 (ChT Produkte)

Synonyme: CHT antikoerper, CHT1 antikoerper, HMN7A antikoerper, hCHT antikoerper, Cht1 antikoerper, solute carrier family 5 member 7 antikoerper, solute carrier family 5 (choline transporter), member 7 antikoerper, SLC5A7 antikoerper, Slc5a7 antikoerper

Hintergrund: Choline is a direct precursor of acetylcholine (ACh), a neurotransmitter of the central and peripheral nervous system that regulates a variety of autonomic, cognitive, and motor functions. SLC5A7 is a Na(+)- and Cl(-)- dependent high-affinity transporter that mediates the uptake of choline for acetylcholine synthesis in cholinergic neurons.

Molekulargewicht: 63 kDa (MW of target protein)