FOLR1 Antikörper
-
- Target Alle FOLR1 Antikörper anzeigen
- FOLR1 (Folate Receptor 1 (Adult) (FOLR1))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FOLR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FOLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF
- Top Product
- Discover our top product FOLR1 Primärantikörper
-
anti-Folate Receptor 1 (Adult) (FOLR1) (AA 41-227) antibody
FOLR1 Reaktivität: Human WB, ELISA, IHC, FACS, ICC Wirt: Maus Monoclonal 2G5C12 unconjugated
anti-Folate Receptor 1 (Adult) (FOLR1) (AA 25-93) antibodyFOLR1 Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Folate Receptor 1 (Adult) (FOLR1) antibodyFOLR1 Reaktivität: Human WB, IHC Wirt: Kaninchen Monoclonal unconjugated
anti-Folate Receptor 1 (Adult) (FOLR1) (Middle Region) antibodyFOLR1 Reaktivität: Human, Ratte, Maus, Rind (Kuh), Pferd, Kaninchen, Hund, Meerschweinchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Folate Receptor 1 (Adult) (FOLR1) (AA 25-234) antibodyFOLR1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Folate Receptor 1 (Adult) (FOLR1) (AA 33-68), (N-Term) antibodyFOLR1 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB28535 unconjugated
anti-Folate Receptor 1 (Adult) (FOLR1) (AA 41-227) antibodyFOLR1 Reaktivität: Human WB, ELISA, IHC, FACS, ICC, Neut Wirt: Maus Monoclonal 3G12B7 unconjugated
anti-Folate Receptor 1 (Adult) (FOLR1) (AA 25-234) antibodyFOLR1 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Folate Receptor 1 (Adult) (FOLR1) antibody (Biotin)FOLR1 Reaktivität: Rind (Kuh) WB, ELISA, IP Wirt: Ziege Polyclonal Biotin
anti-Folate Receptor 1 (Adult) (FOLR1) (AA 179-228) antibodyFOLR1 Reaktivität: Human, Ratte, Maus, Pferd, Kaninchen, Hund, Fledermaus, Hamster WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FOLR1 Blocking Peptide, catalog no. 33R-3731, is also available for use as a blocking control in assays to test for specificity of this FOLR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOLR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FOLR1 (Folate Receptor 1 (Adult) (FOLR1))
- Andere Bezeichnung
- FOLR1 (FOLR1 Produkte)
- Synonyme
- FBP antikoerper, FOLR antikoerper, fbp antikoerper, folr antikoerper, folr1 antikoerper, FBP1 antikoerper, Folbp-1 antikoerper, Folbp1 antikoerper, Fbp1 antikoerper, FOLR1 antikoerper, Folr1 antikoerper, folate receptor 1 antikoerper, folate receptor 1 (adult) antikoerper, folate receptor 1 (adult) L homeolog antikoerper, zgc:165502 antikoerper, Folate receptor alpha antikoerper, folate receptor alpha antikoerper, FOLR1 antikoerper, folr1 antikoerper, folr1.L antikoerper, zgc:165502 antikoerper, Folr1 antikoerper, LOC100066084 antikoerper, LOC100725439 antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-
