FOLR1 Antikörper

Produktnummer ABIN635782

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch FOLR1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für FOLR1 Antikörper (ABIN635782)

Target: FOLR1 (Folate Receptor 1 (Adult) (FOLR1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FOLR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FOLR1 Antikörper

Aufreinigung: Affinity purified

Immunogen: FOLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FOLR1 Blocking Peptide, (ABIN939117), is also available for use as a blocking control in assays to test for specificity of this FOLR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOLR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FOLR1

Target: FOLR1 (Folate Receptor 1 (Adult) (FOLR1))

Andere Bezeichnung: FOLR1

Hintergrund: The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport